PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000896053
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 297aa    MW: 33594.4 Da    PI: 7.1519
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000896053genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.41.8e-141562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd++l +++ ++G g+W++++    + R +k+c++rw +yl
    MDP0000896053 15 KGLWSPEEDLRLRNYILKHGHGCWSSVPINADLQRNGKSCRLRWINYL 62
                     678*******************************************97 PP

2Myb_DNA-binding551.8e-1768113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg ++++E+e ++ ++++lG++ W+ Ia++++ gRt++++k++w++yl
    MDP0000896053  68 RGTFSKQEEETILTLHHMLGNK-WSQIAQHLP-GRTDNEIKNYWHSYL 113
                      899*******************.*********.************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.0721062IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.0E-211065IPR009057Homeodomain-like
SuperFamilySSF466895.14E-2813109IPR009057Homeodomain-like
SMARTSM007171.2E-91464IPR001005SANT/Myb domain
PfamPF002499.2E-131562IPR001005SANT/Myb domain
CDDcd001671.18E-81862No hitNo description
PROSITE profilePS5129426.41163117IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.9E-2666117IPR009057Homeodomain-like
SMARTSM007171.2E-1667115IPR001005SANT/Myb domain
PfamPF002491.3E-1668113IPR001005SANT/Myb domain
CDDcd001671.05E-1170113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MGCRPSDKPK AKHRKGLWSP EEDLRLRNYI LKHGHGCWSS VPINADLQRN GKSCRLRWIN  60
YLRPGLKRGT FSKQEEETIL TLHHMLGNKW SQIAQHLPGR TDNEIKNYWH SYLKKQVAKA  120
DETMEGQRKS QYTSTSSSEI LECSPSPQKS TTGINPSYES LQKPPPFDDL SKDQNCHLSP  180
LPKIMFAEWL SLDHVHGGSF ANNISDTGVS REGFDHSTTS NNLQADHDLG HGFELTNEGT  240
FGSGFHHGIS HHHGSGLEMI NSQYKFEEQI SGTAFVDFVD LCSDFNLQND AMYFYK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-22151177108B-MYB
1h8a_C4e-221511727128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008376568.10.0PREDICTED: transcription factor LAF1
SwissprotQ9M0K44e-60LAF1_ARATH; Transcription factor LAF1
TrEMBLM5XTG91e-163M5XTG9_PRUPE; Uncharacterized protein
STRINGPOPTR_0015s13190.11e-98(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38303161
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52260.13e-62myb domain protein 19